DSUP mbecich

From BioE80 Boot
Jump to: navigation, search

Author Information

Michael Becich

Basic Information

  • ID: DSUP_mbecich
  • Name: Dsup (Damage suppressor protein)
  • Organism: Ramazzottius varieornatus (Water bear) (Tardigrade)
  • Description: Unique DNA-associating protein that contributes to the exceptional tolerance to harsh environmental stresses.[1] Suppresses X-ray-induced DNA damage including single-strand breaks (SSBs) as well as more hazardous double-strand breaks (DSBs) and improves radiotolerance.[2] Shields also DNA against reactive oxygene species (ROS). [3] [4]
  • DNA Length: 1359 base pairs.
  • DNA sequence (codon-optimized for K-12 E. coli, start to stop codon):

ATG GCT AGT ACC CAC CAG TCT TCA ACC GAA CCA TCT TCT ACC GGT AAA TCT GAA GAG ACT AAG AAA GAC GCT TCG CAG GGC TCG GGA CAG GAC AGC AAG AAC GTA ACT GTC ACT AAA GGA ACT GGA AGC TCT GCC ACA TCT GCG GCG ATC GTG AAG ACC GGT GGG AGC CAA GGA AAG GAC AGC AGT ACT ACC GCA GGA TCG TCA AGC ACA CAA GGC CAA AAA TTT TCC ACC ACC CCT ACG GAT CCC AAA ACC TTC TCC TCC GAT CAG AAG GAG AAG AGT AAG TCA CCG GCT AAA GAA GTA CCA TCG GGC GGT GAT AGC AAG TCC CAG GGG GAC ACT AAA TCA CAG TCG GAT GCA AAA TCT AGT GGC CAG TCG CAG GGG CAA TCC AAG GAT AGC GGC AAA AGT TCC TCG GAC TCT TCC AAG TCC CAC AGT GTC ATC GGC GCA GTG AAG GAT GTC GTT GCT GGT GCG AAA GAT GTA GCG GGT AAA GCG GTG GAA GAC GCT CCA TCT ATC ATG CAT ACT GCA GTC GAC GCA GTC AAA AAC GCG GCG ACG ACG GTT AAA GAC GTT GCA TCG AGT GCG GCG AGT ACT GTT GCT GAG AAA GTC GTG GAT GCT TAC CAC TCC GTA GTC GGC GAC AAA ACT GAC GAT AAA AAA GAA GGA GAG CAT AGC GGT GAC AAA AAG GAC GAT TCC AAG GCC GGG AGC GGT TCT GGC CAA GGT GGG GAC AAC AAA AAA AGC GAA GGG GAG ACG AGT GGA CAA GCG GAA TCC TCG AGT GGG AAT GAA GGA GCA GCA CCG GCA AAG GGA CGC GGT CGT GGT CGC CCC CCG GCT GCC GCA AAA GGT GTC GCA AAG GGA GCA GCC AAA GGC GCA GCG GCG TCG AAA GGC GCT AAA TCG GGA GCC GAA TCG TCA AAA GGA GGT GAA CAG AGT TCC GGT GAC ATC GAG ATG GCT GAC GCT AGC AGC AAG GGC GGG AGC GAT CAG CGT GAT TCA GCG GCG ACT GTC GGC GAG GGC GGT GCG TCG GGT AGT GAA GGG GGC GCG AAG AAG GGA CGT GGC CGC GGT GCG GGA AAG AAA GCC GAT GCG GGA GAC ACA TCT GCA GAG CCC CCC CGC CGT TCA AGT CGT TTG ACT AGT AGC GGT ACA GGG GCT GGA AGC GCA CCG GCT GCT GCC AAG GGT GGT GCT AAG CGC GCT GCT AGT TCT TCG TCG ACG CCA AGC AAT GCG AAA AAA CAA GCC ACC GGA GGG GCC GGA AAA GCT GCC GCG ACG AAG GCG ACG GCT GCG AAG TCT GCT GCC TCT AAG GCT CCT CAG AAT GGT GCC GGT GCC AAG AAG AAA GGC GGC AAG GCA GGT GGT CGC AAG CGT AAA TAA

  • Amino Acid length: 453 amino acids.
  • Amino Acid sequence:

MASTHQSSTEPSSTGKSEETKKDASQGSGQDSKNVTVTKGTGSSATSAAIVKTGGSQGKD SSTTAGSSSTQGQKFSTTPTDPKTFSSDQKEKSKSPAKEVPSGGDSKSQGDTKSQSDAKS SGQSQGQSKDSGKSSSDSSKSHSVIGAVKDVVAGAKDVAGKAVEDAPSIMHTAVDAVKNA ATTVKDVASSAASTVAEKVVDAYHSVVGDKTDDKKEGEHSGDKKDDSKAGSGSGQGGDNK KSEGETSGQAESSSGNEGAAPAKGRGRGRPPAAAKGVAKGAAKGAAASKGAKSGAESSKG GEQSSGDIEMADASSKGGSDQRDSAATVGEGGASGSEGGAKKGRGRGAGKKADAGDTSAE PPRRSSRLTSSGTGAGSAPAAAKGGAKRAASSSSTPSNAKKQATGGAGKAAATKATAAKS AASKAPQNGAGAKKKGGKAGGRKRK*

Function and Homologs

  • Product: Single protein product (damage suppressor protein).
  • Closest homologous proteins: None. Unique to Tardigrades. See Accession Number P0DOW4.1
  • Equivalent E. coli / JCVI functional protein: None.

Expression

  • Expression Level: High
  • Expression Level Hypothesis: Tardigrades are resilient largely due to this protein's expression continually protecting and repairing DNA. As extremophiles, we would expect high expression from the onset which makes tardigrades so unique.
  • Expression Level References and Description: Radiotolerance lessons[5] combined with intuition from prior research. * Expression Time: right at beginning or unknown/impossible to tell
  • Expression Level Hypothesis: Based on the aforementioned reasoning, it make sense from an evolutionary standpoint for the cell to highly express Dsup from the beginning; however, because tardigrades have such a long lifespan, this gene expression may be delayed until adulthood when the organism is exposed to harsh conditions.
  • Expression Time References and Description: Intuition from prior research.

Gene Context

  • Other Components: since the coding corresponds to the sole protein which associates with DNA to give protective properties, there are no other components in the functional module described.
  • Possible Dependencies: recA The protein recA is required for homologous recombination and the bypass of mutagenic DNA lesions by the global SOS response.[6]Since the SOS is a system for global DNA repair, it may interact with the DNA Damage Suppressor Protein and mediates its activity.
  • Process: DNA binding
    • Inputs: Unbound DNA, DSUP
    • Outputs: Bound DNA-DSUP complex --> oxygene-resistance and radiotolerance with protection against SSBs and DSBs

Construct

We will handle this - not part of your assignment

  • Synthesis Score: The synthesis score: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details:
  • GenBank File: A link to the GenBank file. file
  • PubMed:27649274
  • PubMed:27649274
  • PubMed:27649274
  • http://www.uniprot.org/uniprot/P0DOW4
  • http://cristivlad.com/radiotolerance-lessons-from-the-tardigrades/
  • http://www.uniprot.org/uniprot/P0A7G6
  • Retrieved from "http://e80boot.org/index.php?title=DSUP_mbecich&oldid=14704"