EG10360

From BioE80 Boot
Jump to: navigation, search

Author Information

Eleanor Glockner

Basic Information

  • ID: EG10360
  • Name: EF-G: translation elongation factor G
  • Organism: E. coli
  • UniProt ID: P0A6M8 [1]
  • Description: This protein catalyzes movement of tRNA from the A and P sites to the P and E sites during translation. [2]
  • DNA Length: 2118 base pairs
  • DNA sequence:

ATGGCTCGTA CAACACCCAT CGCACGCTAC CGTAACATCG GTATCAGTGC GCACATCGACGCCGGTAAAA CCACTACTAC CGAACGTATT CTGTTCTACA CCGGTGTAAA CCATAAAATCGGTGAAGTTC ATGACGGCGC TGCAACCATG GACTGGATGG AGCAGGAGCA GGAACGTGGTATTACCATCA CTTCCGCTGC GACTACTGCA TTCTGGTCTG GTATGGCTAA GCAGTATGAGCCGCATCGCA TCAACATCAT CGACACCCCG GGGCACGTTG ACTTCACAAT CGAAGTAGAACGTTCCATGC GTGTTCTCGA TGGTGCGGTA ATGGTTTACT GCGCAGTTGG TGGTGTTCAGCCGCAGTCTG AAACCGTATG GCGTCAGGCA AACAAATATA AAGTTCCGCG CATTGCGTTCGTTAACAAAA TGGACCGCAT GGGTGCGAAC TTCCTGAAAG TTGTTAACCA GATCAAAACCCGTCTGGGCG CGAACCCGGT TCCGCTGCAG CTGGCGATTG GTGCTGAAGA ACATTTCACCGGTGTTGTTG ACCTGGTGAA AATGAAAGCT ATCAACTGGA ACGACGCTGA CCAGGGCGTAACCTTCGAAT ACGAAGATAT CCCGGCAGAC ATGGTTGAAC TGGCTAACGA ATGGCACCAGAACCTGATCG AATCCGCAGC TGAAGCTTCT GAAGAGCTGA TGGAAAAATA CCTGGGTGGTGAAGAACTGA CTGAAGCAGA AATCAAAGGT GCTCTGCGTC AGCGCGTTCT GAACAACGAAATCATCCTGG TAACCTGTGG TTCTGCGTTC AAGAACAAAG GTGTTCAGGC GATGCTGGATGCGGTAATTG ATTACCTGCC ATCCCCGGTT GACGTACCTG CGATCAACGG TATCCTGGACGACGGTAAAG ACACTCCGGC TGAACGTCAC GCAAGTGATG ACGAGCCGTT CTCTGCACTGGCGTTCAAAA TCGCTACCGA CCCGTTTGTT GGTAACCTGA CCTTCTTCCG TGTTTACTCCGGTGTGGTTA ACTCTGGTGA TACCGTACTG AACTCCGTGA AAGCTGCACG TGAGCGTTTCGGTCGTATCG TTCAGATGCA CGCTAACAAA CGTGAAGAGA TCAAAGAAGT TCGCGCGGGCGACATCGCTG CTGCTATCGG TCTGAAAGAC GTAACCACTG GTGACACCCT GTGTGACCCGGATGCGCCGA TCATTCTGGA ACGTATGGAA TTCCCTGAGC CGGTAATCTC CATCGCAGTTGAACCGAAAA CCAAAGCTGA CCAGGAAAAA ATGGGTCTGG CTCTGGGCCG TCTGGCTAAAGAAGACCCGT CTTTCCGTGT ATGGACTGAC GAAGAATCTA ACCAGACCAT CATCGCGGGTATGGGCGAAC TGCACCTCGA CATCATCGTT GACCGTATGA AGCGTGAATT CAACGTTGAAGCGAACGTAG GTAAACCGCA GGTTGCTTAC CGTGAAACTA TCCGCCAGAA AGTTACCGATGTTGAAGGTA AACACGCGAA ACAGTCTGGT GGTCGTGGTC AGTATGGTCA TGTTGTTATCGACATGTACC CGCTGGAGCC GGGTTCAAAC CCGAAAGGCT ACGAGTTCAT CAACGACATTAAAGGTGGTG TAATCCCTGG CGAATACATC CCGGCCGTTG ATAAAGGTAT CCAGGAACAGCTGAAAGCAG GTCCGCTGGC AGGCTACCCG GTAGTAGACA TGGGTATTCG TCTGCACTTCGGTTCTTACC ATGACGTTGA CTCCTCTGAA CTGGCGTTTA AACTGGCTGC TTCTATCGCCTTTAAAGAAG GCTTTAAGAA AGCGAAACCA GTTCTGCTTG AGCCGATCAT GAAGGTTGAAGTAGAAACTC CGGAAGAGAA CACCGGTGAC GTTATCGGTG ACTTGAGCCG TCGTCGTGGTATGCTCAAAG GTCAGGAATC TGAAGTTACT GGCGTTAAGA TCCACGCTGA AGTACCGCTGTCTGAAATGT TCGGATACGC AACTCAGCTG CGTTCTCTGA CCAAAGGTCG TGCATCATACACTATGGAAT TCCTGAAGTA TGATGAAGCG CCGAGTAACG TTGCTCAGGC CGTAATTGAAGCCCGTGGTA AATAA

  • Amino Acid length: 715 amino acids
  • Amino Acid sequence:

MARTTPIARYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHDGAATMDWMEQEQERG ITITSAATTAFWSGMAKQYEPHRINIIDTPGHVDFTIEVERSMRVLDGAVMVYCAVGGVQ PQSETVWRQANKYKVPRIAFVNKMDRMGANFLKVVNQIKTRLGANPVPLQLAIGAEEHFT GVVDLVKMKAINWNDADQGVTFEYEDIPADMVELANEWHQNLIESAAEASEELMEKYLGG EELTEAEIKGALRQRVLNNEIILVTCGSAFKNKGVQAMLDAVIDYLPSPVDVPAINGILD DGKDTPAERHASDDEPFSALAFKIATDPFVGNLTFFRVYSGVVNSGDTVLNSVKAARERF GRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTLCDPDAPIILERMEFPEPVISIAV EPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGELHLDIIVDRMKREFNVE ANVGKPQVAYRETIRQKVTDVEGKHAKQSGGRGQYGHVVIDMYPLEPGSNPKGYEFINDI KGGVIPGEYIPAVDKGIQEQLKAGPLAGYPVVDMGIRLHFGSYHDVDSSELAFKLAASIA FKEGFKKAKPVLLEPIMKVEVETPEENTGDVIGDLSRRRGMLKGQESEVTGVKIHAEVPL SEMFGYATQLRSLTKGRASYTMEFLKYDEAPSNVAQAVIEARGK

Function and Homologs

  • Product: Elongation factor G
  • Closest homologous proteins:
    • Elongation factor G (proteobacteria, multispecies), 1451/100%/0.0/100% [3]
    • Elongation factor G (Shigella boydii), 1449/100%/0.0/99% [4]
    • Elongation factor G (enterobacteriaceae), 1449/100%/0.0/99% [5]

Expression

  • Expression Level: high
  • Expression Level Hypothesis: The protein produced by this gene aids in translation, which is an important process essential for cell function. According to EcoCyc, this gene produces the most abundant protein in E. coli.
  • Expression Level References and Description: E. coli proteomic expression data [6]; Uniprot [7]
  • Expression Time: right at beginning
  • Expression Level Hypothesis: Because this gene helps facilitate translation, it is important for it to be expressed early to aid in biosynthesis of essential proteins.
  • Expression Time References and Description: Uniprot [8]

Gene Context

  • Other Components: ribosome, tRNA
  • Possible Dependencies: GTP
  • Process: translation
    • Inputs: mRNA, tRNA
    • Outputs: proteins coded by mRNA