EG10667

From BioE80 Boot
Jump to: navigation, search

Author Information

Karen Dai

Basic Information

  • ID: EG10667
  • Name: nusG
  • Organism: E. coli
  • Description: NusG encodes the transcription termination/antitermination protein NusG. This protein is needed for certain types of Rho-dependent termination. Rho-dependent termination involves the rho protein, which binds to RNA-polymerase to detach it from the DNA its transcribing, thereby terminating transcription [1]. Rho is a ring-shaped ring-shaped protein with both helicase and ATPase functionalities. Its helicase activity is what ultimately releases the the mRNA in termination [2] NusG binds to Rho which increases the efficiency of Rho-dependent termination, possibly overcoming a kinetic limitation of Rho’s functionality [3]. When Rho is not present, NusG increases the rate of transcription elongation by suppressing RNA-polymerase pausing to a certain extent [4]. NusG is also utilized in the antitermination of ribosomal RNA and lambda phage transcription [5].


  • DNA Length: 543 base pairs.
  • DNA sequence:

ATG TCA GAG GCT CCG AAG AAG CGT TGG TAC GTT GTA CAA GCT TTC TCG GGT TTC GAG GGC CGC GTA GCC ACA TCA TTG CGT GAG CAT ATC AAG CTT CAT AAT ATG GAA GAC CTT TTC GGA GAA GTA ATG GTG CCA ACA GAA GAA GTA GTG GAA ATT CGT GGC GGG CAG CGC CGT AAA TCA GAA CGT AAA TTC TTT CCA GGA TAT GTC TTG GTC CAG ATG GTT ATG AAT GAC GCC TCG TGG CAT TTG GTA CGC TCG GTG CCT CGC GTA ATG GGC TTC ATT GGC GGT ACG TCA GAT CGT CCG GCC CCT ATC TCG GAT AAG GAA GTG GAT GCC ATT ATG AAT CGT CTG CAA CAA GTG GGT GAT AAA CCG CGC CCA AAG ACT CTG TTC GAG CCT GGT GAG ATG GTG CGC GTG AAT GAC GGG CCT TTT GCC GAT TTC AAT GGT GTG GTC GAA GAG GTT GAT TAC GAG AAG AGC CGC CTG AAG GTC TCC GTG AGC ATC TTC GGA CGC GCA ACT CCG GTC GAA TTA GAT TTT TCC CAG GTC GAG AAA GCA

  • Amino Acid length: 181 amino acids.
  • Amino Acid sequence:

MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISDKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKA

Function and Homologs

  • Product: Transcription termination/antitermination protein NusG
  • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches.
    • MULTISPECIES: transcription termination/antitermination protein NusG (Proteobacteria), 368/100%/5e-129/100%, WP_001287516.1
    • transcription termination/antitermination protein Nusa (Shigella dysenteriae), 366/100%/2e-128/99%, WP_001287518.1
    • MULTISPECIES: transcription termination/antitermination protein NusG (Enterobacterales) , 366/100%/2e-128/99%, WP_001287521.1
  • Equivalent E. coli / JCVI functional protein: MMSYN1_0840.

Expression Level/Time

  • Expression Level Estimate: High
    • Expression Level Hypothesis: The expression level of nusG is estimated to be high since it's involved in the transcription process (specifically elongation and termination), which is a crucial activity in all cells. This is because the resulting mRNA from transcription is then translated to synthesize proteins that are needed for cell growth and cellular functions.
    • Expression Level References and Description: E.coli Proteomic Expression data
  • Expression Time Estimate: Early
    • Expression Time Hypothesis: Since nusG is involved in transcriptional elongation and termination, it is likely that it is expressed early to help facilitate that process early on. Transcription needs to occur early on because the mRNA produced is crucial to the synthesis of proteins that are needed for cellular structure and function.
    • Expression Time References and Description: I made this expression time estimate based on what is known about the importance and ubiquity of the transcriptional process.

Gene Context

  • Other components: EG10665
  • Possible Dependencies: Nucleotide synthesis
  • Process: NusG is involved in transcriptional termination.
    • Inputs: mRNA (with hairpin) + RNA polymerase + Rho (bound) + ATP
    • Outputs: mRNA (free) + RNA polymerase + Rho (unbound) + ADP
    • Reference: [6]


Construct

We will handle this - not part of your assignment

  • Synthesis Score: The synthesis score: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details:
  • GenBank File: A link to the GenBank file. file