EG10917

From BioE80 Boot
Jump to: navigation, search

Author Information

Catherine Lee

Basic Information

  • ID: EG10917
  • Name: rpsR
  • Organism: E. coli
  • Description: rpsR gene encodes 30S ribosomal protein S18. The S18 protein is a component of the 30S subunit of the ribosome [1]. It binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit [2]. It is involved in rRNA binding and translation.
  • DNA Length: 228 base pairs (incl. stop codon)
  • DNA sequence:

ATG GCG CGT TAT TTC CGT CGC CGC AAG TTT TGC CGC TTT ACT GCC GAA GGC GTC CAA GAG ATC GAC TAT AAA GAT ATT GCC ACT CTG AAG AAC TAC ATC ACT GAA TCG GGC AAA ATC GTT CCC AGT CGT ATC ACG GGA ACT CGT GCG AAA TAT CAA CGT CAA CTG GCC CGT GCC ATC AAA CGC GCA CGC TAC TTG AGT CTG TTA CCT TAT ACC GAC CGC CAT CAG TAA

  • Amino Acid length: 75 amino acids
  • Amino Acid sequence:

MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTDRHQ

Function and Homologs

  • Product: 30S ribosomal protein S18
  • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches.
    • 30S ribosomal protein S18 {ECO:0000255|HAMAP-Rule:MF_00270} [Pantoea ananatis], 154 / 100% / 1e-47 / 100%, CRH30984.1
    • 30S ribosomal protein S18 [Edwardsiella piscicida], 154 / 100% / 1e-47 / 100%, GAJ62710.1
    • 30s ribosomal subunit protein S18 [Salmonella enterica subsp. enterica serovar Typhi str. CT18], 154 / 100% / 2e-47 / 100%, NP_458827.1
  • Equivalent E. coli / JCVI functional protein: MMSYN1_0025.

Expression

  • Expression Level: High
  • Expression Level Hypothesis: rpsR is a part of a functioning ribosomes, which the cell needs in order to build all proteins; a large number of ribosomes facilitates fast cell growth.
  • Expression Level References and Description: Annotated high in E. coli proteome, File:EcoliProteomicExpressionData.xlsx.
  • Expression Time: Early
  • Expression Level Hypothesis: Structural component of ribosome, meaning it is involved in translation. Functioning ribosomes are a critical component of producing new proteins: we need to produce more functioning ribosomes in order to synthesize later components.
  • Expression Time References and Description: Research description above.

Gene Context

  • Other Components: rpsF, 30S ribosomal protein S6
  • Possible Dependencies: tRNA ligase. The ribosome requires tRNA to be produced and exist in order to be able to translate.
  • Process: translation elongation

Construct

We will handle this - not part of your assignment

  • Synthesis Score: The synthesis score: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details:
  • GenBank File: A link to the GenBank file. file