EG13427

From BioE80 Boot
Jump to: navigation, search

Author Information

Regina Nguyen

Basic Information

  • ID: EG13427
  • Name: rlmC
  • Organism: E. coli
  • Description: This gene "catalyzes the formation of 5-methyl-uridine at position 747 (m5U747) in 23S rRNA" (source). This is important since the rRNA needs to be processed in order to help with synthesizing proteins.
  • DNA Length: 1128 base pairs.
  • DNA sequence:

ATG CAG TGT GCA TTG TAT GAT GCA GGA CGC TGT CGT AGT TGC CAG TGG ATC ATG CAA CCA ATT CCT GAA CAG TTA TCG GCT AAG ACT GCG GAC CTG AAG AAT TTG CTG GCA GAC TTC CCA GTT GAA GAA TGG TGC GCA CCC GTC AGT GGT CCG GAA CAA GGT TTT CGT AAT AAA GCG AAA ATG GTC GTG TCG GGG TCC GTA GAG AAG CCC TTG TTG GGA ATG TTA CAT CGC GAC GGC ACT CCA GAA GAT TTA TGC GAT TGC CCA CTG TAT CCT GCC AGT TTT GCC CCA GTT TTC GCT GCG CTT AAG CCC TTC ATC GCC CGT GCA GGG TTA ACG CCG TAT AAC GTC GCG CGC AAG CGC GGA GAA TTA AAG TAC ATC TTA CTG ACC GAG TCT CAA AGT GAC GGG GGG ATG ATG CTT CGT TTC GTT CTT CGT TCC GAC ACG AAA CTG GCA CAG TTA CGT AAG GCG CTT CCT TGG TTA CAC GAA CAG TTG CCG CAG TTA AAG GTG ATT ACT GTG AAT ATT CAG CCA GTG CAC ATG GCT ATC ATG GAA GGG GAG ACC GAA ATT TAC TTG ACC GAG CAG CAA GCT CTG GCC GAG CGT TTC AAT GAT GTG CCA TTG TGG ATT CGC CCT CAG AGC TTT TTC CAG ACG AAT CCC GCC GTG GCT TCC CAA CTT TAC GCG ACC GCA CGT GAT TGG GTG CGC CAG CTT CCT GTA AAA CAC ATG TGG GAC CTG TTT TGT GGA GTG GGA GGC TTC GGT TTA CAC TGT GCA ACT CCA GAT ATG CAA TTG ACA GGT ATC GAA ATC GCA TCC GAG GCG ATT GCC TGC GCG AAA CAG TCT GCT GCG GAG CTG GGT TTG ACG CGC TTG CAG TTC CAG GCC TTG GAC TCA ACC CAA TTT GCC ACT GCA CAA GGG GAT GTA CCG GAA CTG GTG TTG GTC AAC CCC CCA CGC CGT GGT ATT GGT AAA CCA CTT TGT GAT TAC TTG TCA ACT ATG GCG CCA CGT TTC ATC ATT TAT AGC TCC TGT AAC GCG CAA ACT ATG GCT AAG GAT ATT CGT GAG CTT CCT GGG TTT CGC ATC GAA CGT GTC CAG TTG TTC GAT ATG TTT CCC CAC ACA GCG CAT TAC GAA GTC CTT ACA TTG CTG GTA AAA CAA TAG

  • Amino Acid length: 376 amino acids.
  • Amino Acid sequence:

MQCALYDAGRCRSCQWIMQPIPEQLSAKTADLKNLLADFPVEEWCAPVSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTPEDLCDCPLYPASFAPVFAALKPFIARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLHEQLPQLKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYATARDWVRQLPVKHMWDLFCGVGGFGLHCATPDMQLTGIEIASEAIACAKQSAAELGLTRLQFQALDSTQFATAQGDVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIYSSCNAQTMAKDIRELPGFRIERVQLFDMFPHTAHYEVLTLLVKQ*

Function and Homologs

  • Product: methyltransferase
  • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches.
    • 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC [Proteobacteria], 779/100%/0.0/100%, WP_001149682.1
    • 23S rRNA (uracil(747)-C(5))-methyltransferase [Escherichia coli], 778/100%/0.0/99%, WP_077167558.1
    • MULTISPECIES: 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC [Enterobacteriaceae], 770/100%/0.0/99%, WP_001149730.1
  • Equivalent E. coli / JCVI functional protein: MMSYN1_0434.

Expression Level/Time

  • Expression Level: high
  • Expression Level Hypothesis: This gene is a part of rRNA processing, and rRNA is essentially for synthesizing proteins.
  • Expression Level References and Description: link to paper
  • Expression Time Estimate: early
  • Expression Time Hypothesis: Since rRNA is used to synthesize proteins, we need to process it early so that proteins can be created.
  • Expression Time References and Description: link to paper

Gene Context

  • Other Components: rRNA
  • Possible Dependencies:
  • Process: rRNA base methylation
    • Inputs: 23S rRNA, methyl group
    • Outputs: 23S rRNA
    • Reference: GO annotation

Construct

We will handle this - not part of your assignment

  • Synthesis Score: The synthesis score: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details:
  • GenBank File: A link to the GenBank file. file