EG20098

From BioE80 Boot
Jump to: navigation, search

Author Information

Sharman Tan

Basic Information

  • ID: EG20098
  • Name: hpt
  • Organism: E. coli
  • Description: Hypoxanthine phosphoribosyltransferase (hpt) acts preferentially on hypoxanthine and has very low activity towards guanine. It is inactive towards xanthine [1]. The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. A purine salvage pathway is a pathway in which purine is synthesized from intermediates in the degradative pathway for nucleotides. Salvage pathways are used to recover bases and nucleosides that are formed during degradation of RNA and DNA. This is important in some organs because some tissues cannot undergo de novo synthesis [2].
  • DNA Length: 537 base pairs.
  • DNA sequence:

ATG AAG CAT ACG GTA GAA GTG ATG ATC CCC GAA GCT GAA ATC AAG GCG CGC ATC GCC GAG TTG GGC CGT CAG ATT ACG GAG CAT TAC AAA GAC TCT GGA TCG GAC ATG GTT TTA GTG GGA CTG TTG CGT GGC TCG TTC ATG TTT ATG GCA GAT TTG TGC CGT GAG GTC CAA GTA TCC CAC GAG GTA GAT TTC ATG ACG GCC TCG AGT TAT GGG AGC GGA ATG TCA ACC ACT CGT GAT GTA AAG ATC CTT AAA GAC CTT GAC GAG GAT ATT CGT GGA AAA GAT GTA CTG ATT GTA GAG GAC ATT ATT GAT AGC GGG AAT ACA TTA AGT AAG GTG CGC GAG ATT CTT TCG CTG CGT GAG CCG AAG TCC TTG GCC ATT TGC ACA TTA CTT GAT AAG CCA TCC CGC CGT GAG GTG AAT GTT CCC GTG GAA TTC ATC GGC TTC TCC ATT CCA GAC GAA TTC GTG GTC GGC TAT GGT ATT GAC TAC GCG CAA CGC TAT CGC CAC CTG CCT TAT ATT GGC AAG GTT ATC CTG TTG GAT GAG TGA

  • Amino Acid length: 178 amino acids.
  • Amino Acid sequence:

MKHTVEVMIPEAEIKARIAELGRQITEHYKDSGSDMVLVGLLRGSFMFMADLCREVQVSHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIGKVILLDE

Function and Homologs

  • Product: Purine nucleotides
  • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches.
    • MULTISPECIES: hypoxanthine phosphoribosyltransferase [Proteobacteria], Max score: 357, Query cover: 100%, E-value: 8e-125, Identity: 99%, WP_000683335.1
    • hypoxanthine phosphoribosyltransferase [Shigella flexneri], Max score: 357, Query Cover: 100%, E-value: 9e-125, Identity: 99%, WP_001307573.1
    • MULTISPECIES: hypoxanthine phosphoribosyltransferase [Escherichia], Max score: 356, Query cover: 100%, E-value: 1e-124, Identity: 99%, WP_000683336.1
  • Equivalent E. coli / JCVI functional protein: MMSYN1_0216.

Expression

  • Expression Level: Medium
  • Expression Level Hypothesis: Because HGPRT is a purine salvage enzyme, it is involved in the synthesis of purine from intermediates in the degradative pathway for nucleotides. Salvage pathways are used to recover bases and nucleosides that are formed during degradation of RNA and DNA, and since nucleotide synthesis is necessary for the organism, it makes sense that HGPRT has a medium expression level.
  • Expression Time: Right at the beginning
  • Expression Time Hypothesis: Because HGPRT is a purine salvage enzyme, it is involved in the synthesis of purine from intermediates in the degradative pathway for nucleotides. Salvage pathways are used to recover bases and nucleosides that are formed during degradation of RNA and DNA, and since nucleotide synthesis is immediately necessary for the organism, it makes sense that HGPRT is expressed right at the beginning of the life cycle of the organism.

Gene Context

  • Other Components: Because HPTGase is enough to catalyze the IMP biosynthesis via salvage pathway, no other components are necessary. [3]
  • Possible Dependencies: Because the inputs for the IMP biosynthesis via salvage pathway, hypoxanthine and guanine, is a naturally occurring purine derivative and a nucleic acid, respectively, there are no upstream enzymes that synthesize either of them. Therefore, there are no dependencies for HPTGase.
  • Process: IMP biosynthesis via salvage pathway
    • Inputs: hypoxanthine, guanine
    • Outputs: inosine monophosphate, guanosine monophosphate

Construct

  • Synthesis Score: The synthesis score of your construct: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details: For example, had to use a rare codon to fix folding energy;
  • GenBank File: [4]