G6635

From BioE80 Boot
Jump to: navigation, search

Author Information

Thomas Fleming (thomasf3)

Basic Information

  • ID: G6635
  • Name: yciO
  • Organism: E. Coli
  • UniProt ID: [1]
  • Description: Its molecular function is to bond double-stranded RNA, and it is found in the cytosol of a cell. [2]
  • DNA Length: 221 base pairs.
  • DNA sequence:

ATGTCCCAATTCTTTTACATTCACCCAGATAATCCGCAACAACGTCTGATCAATCAAGCCGTCGAGATTGTTCGTAAGGGCGGGGTGATTGTGTATCCGACTGATAGTGGGTATGCTCTTGGATGTAAGATCGAGGATAAAAATGCAATGGAACGTATTTGCCGCATTCGTCAGCTTCCTGATGGTCACAACTTTACGCTTATGTGCCGCGATTTGTCCGAACTTTCTACTTACAGTTTTGTCGATAACGTAGCGTTTCGCCTTATGAAAAACAATACGCCAGGTAACTATACTTTTATCTTGAAAGGTACGAAGGAGGTACCTCGCCGTTTACTTCAAGAGAAGCGCAAAACAATTGGGATGCGTGTACCCTCGAATCCTATTGCACAGGCACTTTTAGAAGCATTAGGGGAGCCGATGCTGTCTACTTCACTTATGCTGCCAGGCTCAGAATTTACGGAATCGGACCCTGAAGAAATTAAAGACCGTCTTGAAAAGCAGGTCGACCTGATTATTCACGGCGGATACTTAGGTCAGAAACCAACTACGGTTATTGATTTAACCGACGATACCCCAGTAGTAGTACGTGAAGGAGTTGGTGACGTTAAGCCCTTTCTGTAA

  • Amino Acid length: 206 amino acids.
  • Amino Acid sequence:

MSQFFYIHPDNPQQRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNFTLMCRDLSELSTYSFVDNVAFRLMKNNTPGNYTFILKGTKEVPRRLLQEKRKTIGMRVPSNPIAQALLEALGEPMLSTSLMLPGSEFTESDPEEIKDRLEKQVDLIIHGGYLGQKPTTVIDLTDDTPVVVREGVGDVKPFL

Function and Homologs

  • Product: Uncharacterized protein YciO
  • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches.
    • Uncharacterized protein HI, 322/100%/1e-112/73%, [3]
    • Threonylcarbamoyl-AMP synthase, 94.4/81%/4e-23/32%, [4]
    • Threonylcarbamoyl-AMP synthase, 94.0/81%/6e-23/30%, [5]

Expression

  • Expression Level: [high]
  • Expression Level Hypothesis: I would guess that high expression of this gene speeds up the process of double-stranded RNA binding.
  • Expression Level References and Description: [6]
  • Expression Time: [early]
  • Expression Level Hypothesis: This gene's purpose, as stated above, is double-stranded RNA binding, which would come early in the life of this organism.
  • Expression Time References and Description: [7]

Gene Context

  • Other Components: There are no clear other components in this functional module, although I don't believe that this is the only gene in this functional module.
  • Possible Dependencies: Transcription of RNA, as there needs to be RNA for there to be double-stranded RNA binding.
  • Process: Double-stranded RNA binding (I know this might not be what you were looking for, but there's almost no information on this gene and what it does) [8]
    • Inputs: Double-stranded RNA
    • Outputs: Uncharacterized protein YciO

Construct

We will handle this - not part of your assignment

  • Synthesis Score: The synthesis score: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details:
  • GenBank File: A link to the GenBank file. file