G6856

From BioE80 Boot
Jump to: navigation, search

Author Information

Anthony Agbay

Basic Information

  • ID: G6856
  • Name: ydgD
  • Organism: E. coli
  • Description: The function has not been determined, but the putative function is to regulate the quality of cell envelope proteins through it's cleavage mechanism (Ecocyc).
  • DNA Length: 822 base pairs.
  • DNA sequence:

ATG CGT ACT ACC ATC GCC GTT GTG TTA GGC GCG ATC TCG TTG ACA TCG GCT TTC GTA TTC GCA GAT AAG CCA GAC GTT GCT CGT TCA GCG AAT GAC GAA GTT TCA ACG TTG TTC TTC GGC CAT GAC GAT CGC GTG CCG GTG AAT GAT ACC ACT CAA AGT CCG TGG GAT GCT GTG GGC CAG TTA GAG ACT GCG TCA GGC AAT CTT TGC ACG GCA ACC CTG ATC GCA CCA AAT TTA GCC CTT ACG GCG GGT CAT TGC CTT TTA ACA CCA CCG AAA GGT AAG GCG GAC AAG GCG GTG GCG CTT CGC TTT GTC AGC AAC AAG GGA CTT TGG CGC TAC GAA ATC CAT GAT ATT GAA GGT CGT GTT GAC CCC ACC CTG GGC AAA CGC CTT AAA GCT GAT GGA GAT GGT TGG ATT GTT CCT CCC GCT GCC GCA CCT TGG GAC TTC GGA TTG ATT GTG TTA CGT AAT CCA CCG AGC GGG ATT ACA CCG TTA CCA TTG TTC GAG GGC GAT AAA GCC GCT CTG ACA GCC GCT CTG AAA GCA GCA GGA CGC AAG GTA ACA CAG GCC GGA TAC CCA GAA GAC CAT CTT GAT ACT TTA TAC AGC CAC CAA AAC TGT GAA GTG ACC GGC TGG GCC CAA ACT TCT GTC ATG TCT CAC CAG TGT GAC ACG TTA CCG GGC GAT TCC GGA AGT CCG TTG ATG TTA CAC ACG GAC GAC GGC TGG CAG TTG ATC GGC GTA CAG TCG TCG GCA CCG GCT GCC AAG GAT CGT TGG CGT GCC GAC AAC CGC GCC ATT AGT GTA ACA GGG TTT CGT GAT AAG TTG GAT CAG CTT TCC CAG AAA TAA

  • Amino Acid length: 273 amino acids.
  • Amino Acid sequence:

MRTTIAVVLGAISLTSAFVFADKPDVARSANDEVSTLFFGHDDRVPVNDTTQSPWDAVGQLETASGNLCTATLIAPNLALTAGHCLLTPPKGKADKAVALRFVSNKGLWRYEIHDIEGRVDPTLGKRLKADGDGWIVPPAAAPWDFGLIVLRNPPSGITPLPLFEGDKAALTAALKAAGRKVTQAGYPEDHLDTLYSHQNCEVTGWAQTSVMSHQCDTLPGDSGSPLMLHTDDGWQLIGVQSSAPAAKDRWRADNRAISVTGFRDKLDQLSQK*

Function and Homologs

  • Product: ydgD (serine protease)
  • Module: [Degradation]
  • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches.
    • Hypothetical Protein - Mycoplasma leachii, 1307/100%/0/86%, [1]
    • Hypothetical Protein - Mycoplasma capricolum, 1306/100%/0/86%, [2]
    • MYEA_3900, 771/100%/0/53%, [3]

Expression

  • Expression Level: Low
  • Expression Level Hypothesis: The putative function is cell membrane protein control. However, serine endopeptidases are fairly specific, meaning that each individual peptidase does not need to be highly expressed.
  • Expression Level References and Description: Much of my information came from a review of serine peptidases (Page et al. Cellular and Molecular Life Sciences 2008). A separate paper discussed the mechanism and specificties of serine peptidases in the context of the huge variety of enzymes in the family (Hestrom Chem. Review 2002).
  • Expression Time: Immediately
  • Expression Level Hypothesis: If the putative function of the enzyme is correct, than the ydgD must be expressed immediately to help with the development of the cellular membrane.
  • Expression Time References and Description: The putative function derived from the EcoCyc description. Further searches yielded no additional information.

Gene Context

  • Other Components: There many other components that contribute to the degradation of molecules, including other families of peptidases.
  • Possible Dependencies: Ribosomes, etc.
  • Process: Degradation
    • Inputs: Polypeptides
    • Outputs: Nucleic Acids