MMSYN1 0042 bennett7

From BioE80 Boot
Jump to: navigation, search

Author Information

Jeff Bennett - Senior PD Major. Massive Clown - bennett7

Basic Information

  • ID: MMSYN_0042
  • Name: transcriptional regulator, RpiR family
  • Organism: JCVI
  • UniProt ID: A0A0C3A2S0[1]
  • Description: transcriptional regulator
  • DNA Length: 825 base pairs.
  • DNA sequence:

ATG GAT GTG ACT AAA TTG ATC CTT AAG CTG GAT CAA TTA AGT AAA GAG CAC TCG AGT GCA TCG GGT ATC ACG TCC CGT ATC ATC TTA GAT AAC ATT GAG CTT ATC ACC AAT AGC ACG ATT AGC AAG GTC GCA CAA ATC ACG TAC ACC TCT CCC GCA ACA ATC ACA CGT TTT TGT CAA CGT CAC CTG GAC ATC AGT GGC TTC TCT GAG CTT CAA ACT CTT TTA CGC GTC TAC CTG AAC CAG CAG GAG GAG CAA AAC CGT TTA TTA CTT CAG AAT AAA GAT AAG AAA ATT AGC AAG TTT GAG GAA ATC TCT AAA GCG ATT AAT GCC ACC GAT GCT TTA ATC GAG ACG AAT CAA GTA GAC AAG TTG GTT AAG GCT ATT TAC AAC ACC AAA ACG GTC GCT CTT ATT TCC TAC GAT AAC AGT GTG AAT CAC GCG GTA ACC GAA TTG GCC GAA AAA ATG AAC CTG ATT GGC ATC CCC CCC GTT ATC ATC AAT CAG CAA GAC CTG TTA GAT TAC TAC ACA AAA ATT TCA GAC TCT TCG TGG GTC TTC ATT GTG ATC AGT CAC TTT GCA GAG AAC ATT ACA ACG TAC CAG AGT ATT GTC CAG CTG AAA AAA AAC GGT AGT CGT ATT GGG CTT ATT TCA ATG AAC AAA CCA AAC AAG TAC TCT AGC GTG TGT GAC TAC TGG ATC AAA TAT GCG GTA ACT GAT GCG GAC CCA TTG CAA AAG ATT AAA CAC AGT GCT AAC TTC TCA CTT CTG TAT GTC GTA CAG GTA CTG TTC AAC CGC ATC TTA ACT AAA GAC CAC GAC CGT TTT GAG AAA ATC ATT AAG ACA TTG AAG ATC GAG

  • Amino Acid length: 275 amino acids.
  • Amino Acid sequence:

MDVTKLILKLDQLSKEHSSASGITSRIILDNIELITNSTISKVAQITYTSPATITRFCQRHLDISGFSELQTLLRVYLNQQEEQNRLLLQNKDKKISKFEEISKAINATDALIETNQVDKLVKAIYNTKTVALISYDNSVNHAVTELAEKMNLIGIPPVIINQQDLLDYYTKISDSSWVFIVISHFAENITTYQSIVQLKKNGSRIGLISMNKPNKYSSVCDYWIKYAVTDADPLQKIKHSANFSLLYVVQVLFNRILTKDHDRFEKIIKTLKIE

Function and Homologs

  • Product: The specific protein product of the gene. For example, RNA polymerase subunit alpha
  • Module: DNA-binding transcription // sugars
  • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches.
    • RpiR family transcriptional regulator [Mycoplasma mycoides], 557/100%/0.0/100%, [WP_017698183.1]
    • RpiR family transcriptional regulator [Mycoplasma mycoides], 555/100%/0.0/99%, [WP_013729196.1]
    • RpiR family transcriptional regulator [Mycoplasma mycoides], 545/100%/0.0/97%, [WP_015545419.1]

Expression

  • Expression Level: high
  • Expression Level Hypothesis:
  • Expression Level References and Description: [[2]]
  • Expression Time: at the beginning.
  • Expression Level Hypothesis:
  • Expression Time References and Description: [[3]]

Gene Context

  • Other Components: No other components.
  • Possible Dependencies: no dependencies
  • Process: carbohydrate derivative metabolic process / Pentose Pathway!
    • Inputs: Glucose 6-phosphate, NADP+, H2O
    • Outputs: ribulose 5-phosphate, NADPH, H+, CO2 [4]

Construct

  • Synthesis Score: The synthesis score of your construct: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details: For example, had to use a rare codon to fix folding energy;
  • GenBank File: A link to the GenBank file. file