MMSYN1 0082

From BioE80 Boot
Jump to: navigation, search

Author Information

Michael Morrissey: 06024019

Basic Information

  • ID: MMSYN1_0082
  • Name: rpsT, (a.k.a. 30S ribosomal protein S20)
  • Organism: JCVI3.0
  • Description: The S20 protein is a component of the 30S subunit of the ribosome and appears to be involved in translation initiation and the association of the 30S and 50S subunits [Gotz90]. S20 was also identified as antizyme 1, an inhibitor of the biosynthetic ornithine and arginine decarboxylases; these enzymes are involved in the biosynthesis of polyamine [Panagiotidis84]. Binds directly to 16S ribosomal RNA. Source: inferred from homologous gene description at ecocyc.org
  • DNA Length: 243 base pairs.
  • DNA sequence:

ATGGCTAACATCAAGAGTCAGGAGAAGCGCGTTCTTACCAATGAAAAGTCCCGTTTGGCAAATAAAGCGTTCAAAAGCGAAATCAAGACGGCAATTAAGAAAGCGTTAAATGCAAAGTCCAACGATGATGCGAATAAGGCTGAGCTTGTAAACCATGCAGTTAGCTTAGTAGACAAGGGACTGAAAAAAGGTATCTTTAAAGATAATAAGGCGGCCCGCGAGAAAAGCCGCCTGATGTCGGCG

  • Amino Acid length: 81 amino acids.
  • Amino Acid sequence:

MANIKSQEKRVLTNEKSRLANKAFKSEIKTAIKKALNAKSNDDANKAELVNHAVSLVDKGLKKGIFKDNKAAREKSRLMSA

Function and Homologs

  • Product: 30S ribosomal protein S20.
  • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches.
    • 30S ribosomal protein S20 [Spiroplasma sabaudiense], 124/100%/1e-35/79%, [1]
    • 30S ribosomal protein S20 [Spiroplasma culicicola], 116/97%/1e-32/75%, [2]
    • 30S ribosomal protein S20 [Entomoplasma lucivorax], 111/98%/1e-30/75%, [3]
  • Equivalent E. coli / JCVI functional protein: EG10919.

Expression

  • Expression Level: high.
  • Expression Level Hypothesis: This gene is a subunit, essential to build ribosomes As ribosomes are a prominent feature in any cell, it makes sense that its subunits should be produced in high levels
  • Expression Level References and Description: Mycoplasma genitalium simulation results provided in assignment specs. M genitalium Sim Protein Counts
  • Expression Time: early
  • Expression Time Hypothesis: as new cells grow, building new ribosomes is one of the first things they have to do in order increase protein synthesis capability. This protien is part of building ribosomes
  • Expression Time References and Description: Expression time was gather from functional information of the gene found at [link]

Gene Context

  • Other Components: MMSYN1_0672 rpsJ, ribosomal subunit involved in binding tRNA to the ribosome
  • Possible Dependencies: One possible dependency of the ribosome is histidine biosynthesis because the ribosome requires amino acids in order to be of use.
  • Process: formation of the 30S ribosomal subunit. Sources:(MMSYN1_0672 & http://www.biochem.umd.edul)
    • Inputs: 16s ribosomal RNA & the 30s ribosomal subunit proteins S1-S21
    • Outputs: 30s ribosome subunit

Construct

We will handle this - not part of your assignment

  • Synthesis Score: The synthesis score: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details:
  • GenBank File: A link to the GenBank file. file