MMSYN1 0139

From BioE80 Boot
Jump to: navigation, search

Author Information

Eleanor Glockner

Author Information

Eleanor Glockner

Basic Information

  • ID: MMSYN1_0139
  • Name: DHHA1 domain protein
  • Organism: JCVI-Syn3.0
  • UniProt ID: F4MP27 [1]
  • Description: Nucleic acid binding. [2] Proteins in this family play important roles in DNA repair and recombination pathways, as well as catalyze 5’-3’ degradation of DNA. [3]
  • DNA Length: 951 bp
  • DNA sequence:

ATG CTG GAC CAG AAG AAA TCC CAA CTT TTG CTG GAC AAA ATT AAA CAA TAT CAG AAC ATCATC ATT ACC AAG CAC AAA CAG CCC GAC TGG GAC GCG CAG GGC TCA GCT ATC GGC TTA GCCAAC ATC ATT AAC GAC AAT TTT AAG AAC AAA ACC ATC TAC GTG GTC GGC AGC CGT ATT TCGGAT GAC GAC TCC TTC TTC ATT GAT GAG ACT AAT TTA AGC GAC GAA TTC GTA AAG AAT TCGTTA ATT ATC ACA GTC GAT ACT GCG ACG AAA AAG CGT GTA GAT TTT AAC CGT TTT GAT CTTTCG TGC GAC TCT TTT AAG ATC GAC CAT CAC ATT AAC GTA GAA GAC TAC TGC AAG AAC GACTTA ATT GAC GAC TCC AGT ATT TCT AAT ACT CAA GTC ATT AGC CTT TGG GCC CTT GAG AATGAT CTT TTT ATC AGC CCT ACC GCT GCC TAT AAC CTT TAC TTG GGT CTG TTA ACG GAC TCTAAC CGT TTT TTA TAC GAC AAG ACA AAC CAA ACT ACG TTT TAC GTC GCA TCC AAA TTA TTGGAG GCA GGT GCG AAT CTT AAG AAG GCA AAT GAC TTC CTG TAC GTT TCA GAC CTT AAG TTACGC CAG TGG GTC ATG TAC AGT TTT TCC AAG ATG AAA CTT ACG AAC ACA GGT ATC GCT TATATC GTG CTG TTA GAC GAG GAT TTG AAA GAT TGG GAC TTA TCC TAT GAA GAG ACA AAA TTGGCC TTA TCC GCT ATG TCA GGG ATC AAG GAG ATT AAG ATT TGG TTC ACG ATC ATT CAA GTGGAG GAC ATT CTT AAG GTG TCC CTG CGC TCT CGT GAT TTC TCG ATC GAC AAA ATT GCA AACAAG TAT AAT GGG GGG GGT CAC CGT TTA GCA AGT GGT GCG GAA ATC TCA TCG CTT GAC CAGATC AAT GAC CTT ATC AAT GAC CTT GAG CAA TTA ATT AAG GGC GAG CAA TAG

  • Amino Acid length: 316
  • Amino Acid sequence:

MLDQKKSQLLLDKIKQYQNIIITKHKQPDWDAQGSAIGLANIINDNFKNKTIYVVGSRISDDDSFFIDETNLSDEFVKNSLIITVDTATKKRVDFNRFDLSCDSFKIDHHINVEDYCKNDLIDDSSISNTQVISLWALENDLFISPTAAYNLYLGLLTDSNRFLYDKTNQTTFYVASKLLEAGANLKKANDFLYVSDLKLRQWVMYSFSKMKLTNTGIAYIVLLDEDLKDWDLSYEETKLALSAMSGIKEIKIWFTIIQVEDILKVSLRSRDFSIDKIANKYNGGGHRLASGAEISSLDQINDLINDLEQLIKGEQ

Function and Homologs

  • Product: phosphoesterase DHH family protein
  • Closest homologous proteins:
    • None found using BLASTP
    • RecJ in E. coli [4], [5]
    • Drosophilia prune protein [6]
  • Equivalent E. coli functional protein: EG10034

Expression

  • Expression Level: high
  • Expression Level Hypothesis: There is no specific information on this gene’s expression level, and the default is high. If it is involved in DNA repair and recombination, these are both important functions for ensuring accurate replication, so it is best to have a high level of the protein.
  • Expression Level References and Description: Uniprot [7]
  • Expression Time: early
  • Expression Level Hypothesis: Because there is no clear information on this gene’s function, it would be safest to express it early.
  • Expression Time References and Description: Uniprot [8]

Gene Context

  • Other Components: nucleic acids
  • Possible Dependencies: N/A
  • Process: unknown [9]
    • Inputs: nucleic acids
    • Outputs: altered nucleic acids