MMSYN1 0142 lmaymar

From BioE80 Boot
Jump to: navigation, search

Author Information

Lauren Maymar

Basic Information

  • ID: MMSYN1_0142
  • Name: PrmC
  • Organism: JCVI-Syn3.0
  • UniProt ID: [1]
  • Description: This protein, called release factor glutamine methyltransferase, modifies the peptide release factors RF1/PrfA and RF2/PrfB on the glutamine residue of their GGQ motif. Specifically, it methylates these peptide chain release factors to increase termination efficiency. [2]
  • DNA Length: 848 base pairs
  • DNA sequence:

ATG AAC AAC ACA ATT TTC AAC GTG TTG AAC AAG ATC AAG AAC ACA AAT ATC TCT CTT AAT AAG GCT GAT GTC TAT CAT ATT TTA GAG CAT ATT ATT AAT AAG GAT TAC CAA TGG ATT ATC TCG AAT CTG GAC TAT AAA TTG ACA AAG AAA CAG ATC TAT AAA ATT GAT CAG ATC TTA GAT TTG CTT AAG CAG AAC TAT CCG CTG GCG TAC ATC TTG AAG TCC AAG TAC TTC TAC AGT AAT AAT TTT TTC ATC AAT AAA GAT GTT TTA ATT CCA CGC AAT GAA TCG GAA CTG ATC ATT GAC CAT GCC AGT GAG TTT GTC AAA AAT AAT AAT GAC TTG CTG ATC GTC GAT CTG TGC ACT GGA TCA GGA TGT CTG GGC ATC TCC TGT GCA TTA TTG AAC GAT CAG AAC AAA GTC ATC TTA ACC GAT ATT TCT TAC AAA GCG CTT AAA GTC GCT AAC AAA AAC ATC AAA AAG TTC AAT TTG ACG AAT ACG TCC TGC CTG AAT GGT AAC TTT ATT GAC GTT CTT ATC AAA AAT AAT CTT AAG GCT AAT CTT ATT ATC TGC AAT CCC CCG TAC ATC GAT ATT AAC GAC CAG AAC ATC GAC AAG AAT GTC ATC GAT TTT GAG CCC TCG ATT GCA CTG TTC GCT CCC AAT AAA GGC TTA TAT TTT TAT GAG ATT CTG ATT AAG AAT ATT GAC AAA ATT TTA GAT ACC AAT AAA AAC TTC CTT ATC GTG TTA GAG TTC GGG TGG TTG CAG AAG GAC TCG ATC GAA CAG TTA TTA ATC AAT AAT TGC CTG AAG TAT AAA TGG GAG TTT AAG AAA GAT TAT AAC GAT TAT TGG CGC AAC TTG ATT ATT AAA AAT TTC TAG

  • Amino Acid length: 282 amino acids
  • Amino Acid sequence:

MNNTIFNVLNKIKNTNISLNKADVYHILEHIINKDYQWIISNLDYKLTKKQIYKIDQILDLLKQNYPLAYILKSKYFYSNNFFINKDVLIPRNESELIIDHASEFVKNNNDLLIVDLCTGSGCLGISCALLNDQNKVILTDISYKALKVANKNIKKFNLTNTSCLNGNFIDVLIKNNLKANLIICNPPYIDINDQNIDKNVIDFEPSIALFAPNKGLYFYEILIKNIDKILDTNKNFLIVLEFGWLQKDSIEQLLINNCLKYKWEFKKDYNDYWRNLIIKNF

Function and Homologs

  • Product: Release factor glutamine methyltransferase
  • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches.
    • protein-(glutamine-N5) methyltransferase, release factor-specific [synthetic Mycoplasma mycoides JCVI-syn1.0] , Max score 545/Query Cover 100%/E-Value 0.0/Ident 100%, [ADH21486.1]
    • protein-(glutamine-N5) methyltransferase, release factor-specific [Mycoplasma feriruminatoris] , Max score 498/Query Cover 100%/E-Value 4e-177/Ident 88%, [WP_008362379.1]
    • protein-(glutamine-N5) methyltransferase, release factor-specific [Mycoplasma capricolum], Max score 477/Query Cover 100%/E-Value 6e-169/Ident 85%, [WP_036431278.1]
  • Equivalent E. coli / JCVI functional protein: EG 12424.

Expression

  • Expression Level: [High]
  • Expression Level Hypothesis: There is no concrete information about this in JCVI. But, in e. Coli, cells that do not have this gene expressed do not undergo growth because PrmC is responsible for some methylation within the cell [3]
  • Expression Level References and Description: [4]
  • Expression Time: [Right at the beginning]
  • Expression Level Hypothesis: If the homolog in e. Coli is not expressed right at the beginning, the cell does not undergo growth so I believe that in JCVI the gene should have the same expression time and level.
  • Expression Time References and Description: [5]

Gene Context

  • Other Components: None.
  • Possible Dependencies: Dependent on peptide chain release factor (RF1 or RF2)
  • Process: Termination of translation by the methylation of peptide chain release factors
    • Inputs: S-adenosyl-L-methionine, [peptide chain release factor 1 or 2]-L-glutamine
    • Outputs: S-adenosyl-L-homocysteine, [peptide chain release factor 1 or 2]-N(5)-methyl-L-glutamine

Construct

We will handle this - not part of your assignment

  • Synthesis Score: The synthesis score: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details:
  • GenBank File: A link to the GenBank file. file