MMSYN1 0234

From BioE80 Boot
Jump to: navigation, search

Author Information

Alexander Akesson

Basic Information

  • ID: MMSYN1_0234
  • Name: glucose-specific phosphotransferase enzyme IIA component, crr
  • Organism: JCVI-Syn3.0
  • Description: MMSYN1 0234 codes for the glucose-specific phosphotransferase enzyme IIA component which is part of the sugar transporting phosphotransferase system (PTS) [1]. PTS transports sugars such as glucose, mannose, etc. into prokaryotic cells and then phosphorylates them [2]. In this case, the glucose-specific phosphotransferase enzyme IIA component, is the enzyme that catalyzes the reaction transporting glucose into the cell. It catalyzes the following reaction: [Protein]-N(pi)-phospho-L-histidine + D-glucose(Side 1) <=> [protein]-L-histidine + D-glucose 6-phosphate [3].
  • DNA Length: 465 base pairs.
  • DNA sequence:

ATG TGG TTT TTC AAC AAA AAT TTG AAA GTC CTT GCG CCT TGC GAC GGT AAG ATT ATC ACT TTA GAT GAA GTG GAA GAC GAC GTT TTT CGT GAA CGT ATG CTT GGC GAT GGC TTT GCG ATC TAC CCA ACT TCA AAC GAC TTC CAC GCT CCC GTC TCT GGT AAA TTA GTA ACA GCG TTC CCA ACA AAA CAT GCA TTT GGG ATC CAG ACC AAG AAC GGC GTG GAG ATC TTG CTT CAC ATC GGA CTT GAC ACT GTC TCC TTG GAC GGC AAT GGT TTT GAG TCC TAT GTG ATT CAA GAT CAA GAG GTC AAC GCT GGT GAC AAA TTG GTC ACG GTC GAT TTA CAG GAA GTA TCG AAG AAG GTC CCC TCG ATC AAG TCT CCG ATT ATT TTC ACT AAT AAC GGA GGA AAA ACA TTG GAG ATT GTA AAG ATG GGG GAG GTG AAA AAA GGT GAC GTC GTA GCC ATT TTG AAA TAA

  • Amino Acid length: 154 amino acids.
  • Amino Acid sequence:

MWFFNKNLKVLAPCDGKIITLDEVEDDVFRERMLGDGFAIYPTSNDFHAPVSGKLVTAFPTKHAFGIQTKNGVEILLHIGLDTVSLDGNGFESYVIQDQEVNAGDKLVTVDLQEVSKKVPSIKSPIIFTNNGGKTLEIVKMGEVKKGDVVAILK

Function and Homologs

  • Product: glucose-specific phosphotransferase enzyme IIA component
  • Module: Phosphotransferase system (phosphoenolpyruvate-protein phosphotransferase is part of a larger system, PTS, which transports sugars into the cell).
  • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches.
    • glucose-specific phosphotransferase enzyme IIA component [Mycoplasma feriruminatoris], Max score: 291, Query Cover: 100%, E-Value: 2e-99, Ident: 92%, WP_008363668.1
    • glucose-specific phosphotransferase enzyme IIA component [Mycoplasma capricolum], Max score: 287, Query Cover: 100%, E-Value: 8e-98, Ident: 91%, WP_011387122.1
    • glucose-specific phosphotransferase enzyme IIA component [Mycoplasma leachii], Max score: 285, Query Cover: 100%, E-Value: 4e-97, Ident: 90%, WP_013447592.1
  • Equivalent E. coli / JCVI functional protein: EG10165.

Expression

  • Expression Level: high
  • Expression Level Hypothesis: The crr gene is part of the the phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS). It is needed by the cell since it is the enzyme that catalyzes the reaction transporting glucose into the cell. Glucose is a vital component for the cell.[4].
  • Expression Level References and Description: The ptsP gene was not available in the Mycoplasma genitalium file, but it was found in the E. coli proteome.
  • Expression Time: At which time should the gene be expressed in the lifecycle of our organism? Early
  • Expression Level Hypothesis: Glucose is needed for cell respiration, which is essential for cellular growth. Thus, the gene needs to be expressed early.
  • Expression Time References and Description: Research description above and UniProt.

Gene Context

  • Other Components: glpK glpK, glycerol kinase
  • Possible Dependencies: Histidine kinase A histidine kinase is needed since it is the enzyme that catalyzes the reaction that adds a phosphate group to the protein L-histidine [1]. This in turn, creates [Protein]-N(pi)-phospho-L-histidine which is needed for this reaction.[2][3].
  • Process: phosphoenolpyruvate-dependent sugar phosphotransferase system
    • Inputs: [Protein]-N(pi)-phospho-L-histidine, D-glucose(Side 1)
    • Outputs: [protein]-L-histidine, D-glucose 6-phosphate(Side 2)
    • Reference: [4]

Construct

  • Synthesis Score: The synthesis score of your construct: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details: For example, had to use a rare codon to fix folding energy;
  • GenBank File: A link to the GenBank file. file
  • http://enzyme.expasy.org/EC/2.7.1.199]
  • https://en.wikipedia.org/wiki/Phosphotransferase#Phosphotransferase_system
  • http://enzyme.expasy.org/EC/2.7.1.199]
  • http://www.uniprot.org/uniprot/P69783
  • Retrieved from "http://e80boot.org/index.php?title=MMSYN1_0234&oldid=10532"