MMSYN1 0264 ccamach

From BioE80 Boot
Jump to: navigation, search

Author Information

Camila Camacho

Basic Information

  • ID: MMSYN1_0264
  • Name: pkn
  • Organism: JCVI-Syn3.0
  • Description: Unknown function. According to a protein blast, this gene is most likely a "serine/threonine protein kinase". A serine/threonine protein kinase is a kinase enzyme that phosphorylates the OH group of serine or threonine (which have similar sidechains). Serine/threonine protein kinase describes a class of enzymes that belong to the family of transferases, specifically protein-serine/threonine kinases. These enzymes transfer phosphates to the oxygen atom of a serine or threonine sidechain in proteins. This process is called phosphorylation. Protein phosphorylation in particular plays a significant role in a wide range of cellular processes and is a very important posttranslational modification. The chemical reaction performed by these enzymes can be written as ATP + a protein -> ADP + a phosphoprotein. Thus, the two substrates of this enzyme are ATP and a protein, whereas its two products are ADP and phosphoprotein. The protein encoded by this gene (pkn) belongs to the protein kinase C superfamily. PKC-related serine/threonine-protein kinase involved in various processes such as regulation of the intermediate filaments of the actin cytoskeleton, cell migration, tumor cell invasion and transcription regulation. This kinase is activated by Rho family of small G proteins and may mediate the Rho-dependent signaling pathway. This kinase can be activated by phospholipids and by limited proteolysis. The 3-phosphoinositide dependent protein kinase-1 (PDPK1/PDK1) is reported to phosphorylate this kinase, which may mediate insulin signals to the actin cytoskeleton. The proteolytic activation of this kinase by caspase-3 or related proteases during apoptosis suggests its role in signal transduction related to apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
  • DNA Length: 1,113 base pairs.
  • DNA sequence:

ATG CCA AAG ACG AAA AAA GAT CTT GGT ATC AAC AAA GAG GAA CTT CTT AAC CAG GTC GTC AAT AAC AGA TAT AAA TTG ATT AAG TAC CTT AAC TCG GGA GCC TTT GCC GTT GTA TTT AAG GCC CTT GAC TTA GAT GCA TCC GTT CTT GAA AAG AAA GAC GTC TTT GTT GCG GTT AAG ATC ATT TTA AAG GCC AAG AAC AAG AAT ATT GAA ACA ATT AAG AAG CGT TTG TTC CTT GAA ACC AAT ACG TTT GCT AAG CTT TCT TTC TCA AAG AAC ATA GTT AAA ATG AAA GAC GTC TTC TCT TGG CAA AAC TAC TAC GTC ATT GTA ATG GAA CTT ATT GAA GGA GCG GAT TTA TCG AAA AAA TTC AAC GCG TAT AAT AAT GTA CTT TCT AAT AAA GAA TTC TTG TAC TAT TTC CTT CAG ATT ACC AAA GGA CTG AAA GAA ATA CAT GAC AAT AAC ATA ATT CAT CGG GAT GTA AAG CCG GCA AAC ATA CTT ATT ACC AAC GAT AGC AAG GTT CGC ATA TCG GAT TTC GGA ATC AGT AAA ATA AAG AGT ATC ATT TTA GAT GAC CAC CAT AAC CAT ATC TCA CCC GGA ACA CCA CGT TAC ACG GCA CCC GAG CAA TTC ATT AAC TTT GAA TCG AGA AAA GAC GCA TTC TAT TTT GAG TCG GAT ATA TAC TCC ATT GGA GTT ATT ATG TAC GAG TTC CTG ACT GGC TCC ATG TTG TAC TTA AAT TAT GGA TCA AAT CAC ACG TCC TCT AAA GAA AAA GAG CGC ACG AAT TTC CAG CAA CAT ATA TTG AAG GAC ATA ACG CGG CCC CGC GAA ATA AAT CCA AAT ATC TCC CAA GCC TTA GAA AAC ATT ATA ATG AAA TGT CTG GCT AAG GAT TAT AAG AAT CGG TAT CAT CGC TTT GAC CAG ATT ATT GAA GAC TTA GAA CAA GCG AAG CAG CAG CCT GAC GTG AAT ATC GAC TTT CCT AAT ATG TGG TGG GAA GAT GAA AAT TAT TTG AAT ATT AAG AAC AAC AAC ACT TTG AAG TAT AAA TAC TTT TTT AAG AAT ACG AAT TTC AAA TAC TTT TTA TTC TGG ATC AGT ATT GTT ATA AGC TTG TTC ATA ATC TTC CTG ATC GTC CTT ATA CTT AAG TAA

  • Amino Acid length: 371 amino acids.
  • Amino Acid sequence:

MPKTKKDLGINKEELLNQVVNNRYKLIKYLNSGAFAVVFKALDLDASVLEKKDVFVAVKIILKAKNKNIETIKKRLFLETNTFAKLSFSKNIVKMKDVFSWQNYYVIVMELIEGADLSKKFNAYNNVLSNKEFLYYFLQITKGLKEIHDNNIIHRDVKPANILITNDSKVRISDFGISKIKSIILDDHHNHISPGTPRYTAPEQFINFESRKDAFYFESDIYSIGVIMYEFLTGSMLYLNYGSNHTSSKEKERTNFQQHILKDITRPREINPNISQALENIIMKCLAKDYKNRYHRFDQIIEDLEQAKQQPDVNIDFPNMWWEDENYLNIKNNNTLKYKYFFKNTNFKYFLFWISIVISLFIIFLIVLILK

Function and Homologs

  • Functional Category: Unclear (Most likely Translation)
  • Product: Serine/threonine protein kinase
  • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches.
    • Name: serine/threonine protein kinase [Mycoplasma mycoides]/Max score: 748/Query Cover: 100%/E-value: 0.0/Ident: 100%/Accession: WP_020863089.1
    • Name: kinase [Mycoplasma feriruminatoris]/Max score: 701/Query Cover: 100%/E-value: 0.0/Ident: 92%/Accession: WP_008364454.1
    • Name: serine/threonine protein kinase [Mycoplasma capricolum]/Max score: 674/Query Cover: 100%/E-value: 0.0/Ident: 89%/Accession: WP_036431032.1
  • Equivalent E. coli functional protein: EG11831.

Expression

  • Expression Level: [Low].
  • Expression Level Hypothesis: This enzyme phosphorylates the OH group of serine or threonine. Protein phosphorylation plays a significant role in a wide range of cellular processes and is a very important posttranslational modification, meaning it is probably relatively important to be abundant in the cell. The dataset shows that the expression level for for prkC (serine/threonine protein kinase, putative) is low, meaning that serine/threonine protein kinase might not be an amino acid commonly used in this organism's proteins.
  • Expression Level References and Description: M. genitalium model data: File:MgenitaliumSimProteinCounts.xlsx
  • Expression Time: [Early].
  • Expression Level Hypothesis: Because protein phosphorylation plays a significant role in a wide range of cellular processes and is a very important posttranslational modification, it can be expressed at different times within an organism's lifecycle. Since it is involved in various processes such as regulation of the intermediate filaments of the actin cytoskeleton, cell migration, tumor cell invasion and transcription regulation, it is probably expressed early on.
  • Expression Time References and Description: Serine/threonine-specific protein kinase

Gene Context

  • Other Components in the functional module: Phosphatidylcholine (PC)-specific phospholipases D (PLDs) catalyze the hydrolysis of PC to produce phosphatidic acid and choline, needed. PLD1 encodes a phosphatidylcholine-specific phospholipase, necessary for protein phosphorylation.
  • Possible Dependencies: The 3-phosphoinositide dependent protein kinase-1 (PDPK1/PDK1) is reported to phosphorylate this kinase, which may mediate insulin signals to the actin cytoskeleton
  • Process: Protein phosphorylation
    • Inputs: ATP, a protein
    • Outputs: ADP, a phosphoprotein

Construct

We will handle this - not part of your assignment

  • Synthesis Score: The synthesis score: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details:
  • GenBank File: A link to the GenBank file. file