MMSYN1 0499

From BioE80 Boot
Jump to: navigation, search

Author Information

Gordon Dean

Basic Information

  • ID: MMSYN1_0499
  • Name: rpmA
  • Organism: JCVI-Syn3.0
  • Description: rpmA encodes the 50S ribosomal protein L27 which contributes to the structural integrity of the ribosome (Uniprot). In E.coli, the L27 protein is a component of the 50S subunit of the ribosome and may be an integral and functional component of the peptidyl transferase center [Hindennach71, Chen75]. Single-molecule fluorescence resonance energy transfer studies have indicated that L27 stabilizes the peptidyl-tRNA [Wang12d]. L27 participates both in the assembly of the 50S subunit and in the peptidyl transferase reaction [Wower98, Maguire05]. L27 crosslinks to aminoacylated tRNA in the A and P site [Wower89, Parker83, Rosen93, Osswald95, Maguire05]. Involvement of L27 with the peptidyl transferase center was also suggested by its interactions with various antibiotics: N-bromoacetyl chloramphenicol, an antibiotic that interacts with the peptidyl transferase center, affinity labels L27 [Sonenberg73]. L27 is labeled by the macrolides carbomycin A, niddamycin and tylosin, which inhibit ribosomal activity [Tejedor85]. L27 can also be crosslinked to the spiramycin derivative dihydrospiramycin [Bischof95]. L27 interacts with domain V of 23S rRNA [Osswald90, Urlaub95, Thiede98] and can be crosslinked to L33 [Redl89]. L27 is exposed on the surface of the 70S ribosome [Agafonov97].
  • DNA Length: 279 base pairs.
  • DNA sequence:

ATG CGT TTT TTG CTT GGT CTT CAG TAT TTT GCG TCG AAG AAG GGC GTA GGT TCT ACA AAA AAC GGT CGT GAT TCG GAG TCT AAA CGT CTT GGC GCG AAA AAG TCA GAT GGT CAA TTC ACG AAC GCT GGA TCT ATT ATT TAC CGT CAG CGC GGA ACC AAG ATC CAC CCC GGC CTT AAC GTG GGA CGC GGT GGT GAT GAT ACA CTT TTT GCG TTA ATC GCT GGA ACA GTC AAG TAC GAA AAG TTC GGC AAA AAC CGC ACC CGC GTC TCG GTC ATC CCT AAC

  • Amino Acid length: 93 amino acids.
  • Amino Acid sequence:

MRFLLGLQYFASKKGVGSTKNGRDSESKRLGAKKSDGQFTNAGSIIYRQRGTKIHPGLNVGRGGDDTLFALIAGTVKYEKFGKNRTRVSVIPN

Function and Homologs

  • Product: 50S ribosomal protein L27
  • Closest homologous proteins:
    • MULTISPECIES: 50S ribosomal protein L27 ([Mycoplasma mycoides group), 187/100%/3e-60/100%, WP_008362816.1
    • MULTISPECIES: 50S ribosomal protein L27 (Mycoplasma mycoides group), 184/100%/6e-59/98%, WP_011387289.1
    • 50S ribosomal protein L27 (Mycoplasma capricolum), 176/100%/5e-56/95%, WP_019269413.1
  • Equivalent E. coli / JCVI functional protein: EG50002

Expression

  • Expression Level: high
  • Expression Level Hypothesis: rpmA, which is a part of a functioning ribosome, contributes to building all proteins in a cell, so more ribosomes (and thus more rpmA) will yield faster cell growth.
  • Expression Level References and Description: M. genitalium model data; also annotated high in E. coli proteome
  • Expression Time: Early
  • Expression Level Hypothesis: Functioning ribosomes are necessary in order to produce new proteins, so we need to produce ribosomes early in order to synthesize later components.
  • Expression Time References and Description: Based on the gathered expression and function information

Gene Context

Construct

We will handle this - not part of your assignment

  • Synthesis Score: The synthesis score: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details:
  • GenBank File: A link to the GenBank file. file