MMSYN1 0694

From BioE80 Boot
Jump to: navigation, search

Author Information

Anjini Karthik

Basic Information

  • ID: MMSYN1_0694
  • Name: ptsH
  • Organism: JCVI-Syn3.0
  • UniProt ID: A0A014MGF0: [1]
  • Description: The gene ptsH codes for HPr, a histidine and phosphocarrier protein, which plays an important part in sugar utilization. Specifically, it harbors the capacity to switch between the two alternative metabolic strategies available to the cell (hierarchical sugar utilization versus co-utilization), as part of the phosphoenolpyruvate-dependent phosphotransferase system (PTS)[[2]]. HPr also has a regulatory role, coordinating carbon utilization strategy. Thus, by coding for a sugar active-transport system, ptsH is involved in an essential aspect of the organism’s survival: carbohydrate uptake and consumption. HPr, the protein this gene codes for, acts in partnership with phosphorylated Enzyme 1 and sugar-specific enzymes (Enzymes II) in the cell [[3]].
  • DNA Length: 270 base pairs.
  • DNA sequence:

ATG GCA AAA TTT AGT GCT ATC ATT ACT GAT AAG GTT GGG CTT CAT GCC CGC CCC GCA AGC GTA CTG GCT AAG GAG GCG TCT AAG TTT TCT AGC CAT ATC ACC ATC ATG GCA GGT GAA AAA CAA GGA AAC TTG AAA TCT ATT ATG AAC GTG ATG GCG ATG GCG ATT AAA ACA GGG ACC GAG GTA ACA ATT CAA GCG GAC GGG ACA GAT GAA GAG CAG GCT ATT AAA GCC ATT AAA CAG ACG ATG ATT GAT ACA GCT CTG ATC CAG GGA TAA

  • Amino Acid length: 89 amino acids.
  • Amino Acid sequence:

MAKFSAIITDKVGLHARPASVLAKEASKFSSHITIMAGEKQGNLKSIMNVMAMAIKTGTEVTIQADGTDEEQAIKAIKQTMIDTALIQG*

Function and Homologs

  • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches.
    • HPr (Mycoplasma mycoides), 174/100%/2e-55/95%, [4]
    • HPr (Entoplasma somnilux), 127/100%/2e-36/70%, [5]
    • HPr (Acholeplasma multilocale), 119/98%/3e-33/65%, [6]
  • Equivalent E. coli / JCVI functional protein: EG10788

Expression

  • Expression Level: High
  • Expression Level Hypothesis: Because ptsH is involved in carbohydrate uptake and consumption, it plays a critical role in the survival of the organism. A high expression level for ptsH ensures continuous and effective sugar utilization via an active-transport system.
  • Expression Level References and Description: This information is based on the M. genitalium dataset.
  • Expression Time: Early
  • Expression Level Hypothesis: ptsH must be produced early and often in the cell because it is responsible for managing metabolic pathways that provide the cell with energy. Without energy from sugar consumption, the cell cannot carry out more advanced functions.
  • Expression Time References and Description: Resources used were the same as those cited in the “Basic Information/Description” section.

Gene Context

  • Other Components: GlgP (Glycogen phosphorylase) – there was no explicit JCVI GlgP gene found. However, one was found for E. coli, and the JCVI homolog is linked here: [[7]]
  • Possible Dependencies: PtsI
    • PtsI-P: HPr, the protein that ptsH codes for, accepts a phosphoryl group from phosphorylated Enzyme I (PtsI-P).
    • Enzymes II: HPr then transfers the phosphoryl group to sugar-specific enzymes (Enzymes II).
  • Process: sugar utilization
    • Inputs: sugar, cyclic AMP
    • Outputs: PtsI, phosphoenolpyruvate
    • References: Resources used were the same as those cited in the “Basic Information/Description” section.

Construct

We will handle this - not part of your assignment

  • Synthesis Score: The synthesis score: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details:
  • GenBank File: A link to the GenBank file. file