MMSYN1 0831

From BioE80 Boot
Jump to: navigation, search

Author Information

Jessica Hui

Basic Information

  • ID: MMSYN1_0831
  • Name: prs
  • Organism: JCVI-Syn3.0
  • UniProt ID: [1]
  • Description: Ribose-phosphate diphosphokinase (Prs) transfers a pyrophosphoryl group from ATP to ribose 5-phosphate, synthesizing 5-phospho-α-D-ribose 1-diphosphate (PRPP). PRPP is a pivotal metabolite; a total of 10 enzymes in a variety of biosynthesis and salvage pathways utilize PRPP as substrate. Mg2+ is an activator that may serve as a bridge between PRPP synthetase and the α-phosphate residue of ATP and AMP. Potential active site residues have been identified. Site-directed mutagenesis of conserved aspartate residues was used to identify residues involved in catalysis and binding of ribose-5-phosphate. Kinetic analysis indicates a sequential reaction mechanism. [1] [2]
  • DNA Length: 1,035 base pairs.
  • DNA sequence:

ATG GAC AAC AAG GAC ATC TAC GTG TTC GGT TTA AGT GCT AGC CAA CAG CTG GCG AAG GAA GTA TGT CAT TTT TTA GGT GTC GAA CAA AAG GTT GTA AAA ACA ACT CGT TTC GCT GAT GGG GAA ATT CTG GTT GAA TCA ATC GAT TCG GTT CGT GGA AAG GAA ATC TAC GTA ATT CAA AGT ACA TCG ATG CCG GTA AAC GAA AAT TTA ATG GAA CTG CTT ATT GCG ATC GAC GCT TTC AAG CGT GGA AGC GCG GAA AAG ATT AAC GTG GTA ATT CCC TAT TAC GGC TAC GCA CGC CAG GAT CGC AAG GCT AAG GGC CGC CAA CCT ATT ACA GCG AAG TTG GTC GCT GAT TTA TTG ACA AAA GCC GGG GCA GAT CGC GTC ATC GTG TTT GAT ATT CAC AGT ACT CAA ACC ATG GGT TTC TTC GAT ATG CCG ATG GAC AAC TTT CAC ACA TCC CAA TCC CTG GCG AAT GAG ATC GTT GAT ACT ATC ATC CGC GAG AAG TTT GAT CCG GAA AAG TGC ATC TTG GTT TCG CCA GAC TAT GGT GGT TTA AAC CGC GTG CAT AAA GTC GAC TCT TAT ACC GCA AAC ATG ACA AAC GGT ATT GCT GTC ATC GGC AAG CGC CGT CCC GAA CCA AAT AAA GCT GAG GTA GAG TTT GTC TTA GGT GAC ATT GAG GGG CGC ACA TGT TTC ATC ATT GAC GAC ATG ATT GAC ACA GGA GGC ACG ATT ATT TCT GGG GCT AAG GCA CTG AAG GCA AAC GGG GCG AAA GAT GTC TAC ATC TTC GCT TGT CAT GGC CTT TTC AAC GGG CCC GCA AAA GAG CGC ATG ACG CAG GCT ATC AAA GAG GGC ATC GTA AAA AAT GTC GTT GTT ACT AAC ACA GTA GAA ATC CCG CAA GAG CGC CAA TTC GAG GGG TTG AAG ATC GTA TCT GTA GCT CCC CTG CTT GCA AAT ATG ATT AAG GAA AGC CAG GAG CAC CAT TCT CTT ACC GAG GTC TAC AAT AAG AAC AAA GAT GAG ATT CAA TTA AAA ATT CAA GAT TTT ATG AAC CAC AAA AAC TAG

  • Amino Acid length: 344 amino acids.
  • Amino Acid sequence:

MDNKDIYVFGLSASQQLAKEVCHFLGVEQKVVKTTRFADGEILVESIDSVRGKEIYVIQSTSMPVNENLMELLIAIDAFKRGSAEKINVVIPYYGYARQDRKAKGRQPITAKLVADLLTKAGADRVIVFDIHSTQTMGFFDMPMDNFHTSQSLANEIVDTIIREKFDPEKCILVSPDYGGLNRVHKVDSYTANMTNGIAVIGKRRPEPNKAEVEFVLGDIEGRTCFIIDDMIDTGGTIISGAKALKANGAKDVYIFACHGLFNGPAKERMTQAIKEGIVKNVVVTNTVEIPQERQFEGLKIVSVAPLLANMIKESQEHHSLTEVYNKNKDEIQLKIQDFMNHKN

Function and Homologs

  • Product: Ribose-phosphate pyrophosphokinase
  • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches.
    • ribose-phosphate pyrophosphokinase [Mycoplasma feriruminatoris], 701/100%/0.0/99%, [2]
    • phosphoribosylpyrophosphate synthetase [Mycoplasma capricolum], 696/100%/0.0/98%, [3]
    • phosphoribosylpyrophosphate synthetase [Mycoplasma leachii], 689/100%/0.0/97%, [4]


  • Equivalent E. coli functional protein: EG10774

Expression

  • Expression Level: [medium]
  • Expression Level Hypothesis: Ribose-phosphate diphosphokinase (Prs) is involved in nucleotide synthesis (such as purines), but there might be other genes responsible for purine salvage or synthesis, such as apt. At the same time, prs is also involved in amino acid and cofactor synthesis. Thus, prs is important but not too important, so expression levels are medium.
  • Expression Level References and Description: M. genitalium model data, File:MgenitaliumSimProteinCounts.xlsx
  • Expression Time: [right at the beginning].
  • Expression Level Hypothesis: Because prs plays an important role in synthesizing nucleotides, and central dogma components require nucleotides from the very beginning. So, this gene will likely be expressed at the very beginning as well.
  • Expression Time References and Description: [[5]]

Gene Context

  • Other Components: mgtA - EG12525
  • Possible Dependencies: Magnesium ion binding is necessary because magnesium acts as an activator of this mechanism. [3]
  • Process: AMP formation
    • Inputs: Ribose-5-phosphate, ATP
    • Outputs: Phsophoribosyl pyrophosphate, AMP [4]

Construct

We will handle this - not part of your assignment

  • Synthesis Score: The synthesis score: 1, 2,3
  • Predicted Translation Rate: Prediction of construct translation rate from the RBS calculator
  • Design Notes and Details:
  • GenBank File: A link to the GenBank file. file
  • http://www.uniprot.org/uniprot/C7LLE9
  • https://ecocyc.org/gene?orgid=ECOLI&id=EG10774
  • https://ecocyc.org/gene?orgid=ECOLI&id=EG10774
  • https://en.wikipedia.org/wiki/Ribose-phosphate_diphosphokinase
  • Retrieved from "http://e80boot.org/index.php?title=MMSYN1_0831&oldid=14261"