MMSYN1 xxxx

From BioE80 Boot
Jump to: navigation, search

Template:Db-author

Author information: Meera Srinivasan, msriniva

Gene Specification Sheet MMSYN1_0360 Mycoplasma Mycoides


Basic Information:

ID: MMSYN1_0819 Name: Signal recognition particle protein • Organism: JCVI-Syn3.0 (Mycoplasma mycoides) • Sequence ID (from BLAST): WP_020862694.1 • Description: This gene belongs to the signal recognition particle protein family. Signal recognition particles are involved in the protein trafficking process, namely, in recognizing as well as targeting specific proteins to the endoplasmic reticulum in eukaryotes and the plasma membrane in prokaryotes. This SRP is a ribonucleoprotein, or protein-RNA complex. (Akopian et. al. 2013). • DNA Length: 1347 bp • DNA sequence: ATG GGG TTC GGC GAT TTC TTG TCT AAG CGT ATG CAG AAG TCG ATC GAA AAA AAT ATG AAA AAC TCA ACA CTG AAT GAG GAA AACATC AAG GAA ACC TTG AAA GAG ATT CGT CTT AGC TTG TTA GAG GCG GAT GTA AAT ATC GAA GCC GCT AAG GAG ATT ATC AAT AACGTG AAA CAG AAA GCA TTA GGC GGT TAC ATT TCT GAA GGC GCG AGC GCC CAC CAA CAA ATG ATT AAA ATT GTA CAT GAG GAG TTGGTA AAT ATT CTT GGT AAG GAA AAC GCC CCA CTG GAC ATC AAT AAG AAG CCG TCA GTG GTG ATG ATG GTT GGC CTG CAG GGG AGTGGT AAG ACC ACA ACT GCC AAT AAA TTA GCT TAC CTG CTT AAT AAG AAG AAT AAG AAG AAA GTC TTG TTG GTC GGT CTT GAC ATTTAT CGT CCC GGC GCG ATC GAA CAA TTG GTG CAG TTA GGT CAA AAA ACC AAT ACC CAG GTT TTC GAG AAA GGT AAA CAA GAT CCCGTG AAG ACG GCT GAG CAG GCT TTA CAG TAC GCG AAA GAG AAC AAC TTC GAT GTC GTG ATC TTA GAT ACA GCC GGA CGC CTT CAAGTC GAT CAA TTC TTA ATG AAG GAA CTT GAC AAT CTG AAA AAG AAA ACA TCC CCA AAT GAA ATT TTA CTG GTA GTC GAT GGT ATGAGT GGG CAG GAA ATT ATT AAT GTC ACC AAT GAG TTT AAC TCG AAG CTT AAG CTT AGT GGA GTT GTG GTC ACC AAG TTA GAT GGTGAT GCT CGC GGC GGG GCG ACG CTT TCA ATT TCC TAC CTG ACG AAG TTA CCC ATC AAA TTT ATC GGT GAG GGA GAG GGA TAT AACGCC CTT GCA GCT TTC TAT CCT AAA CGT ATG GCC GAT CGT CTG ATG GGA ATG GGA GAC ATT GAA ACG TTA TTT GAA CGC GCA GTAGAG AAC ATT GAT GAA CGT TCA ATT CAA AAA ACC ATG AAT CGT ATG TTC CTG GGC CAG TTT GAT CTG GAG GAT CTG CGC AAC CAGTTG GCC CAG ATC GCA AAA ATG GGC AGT TTA AAC AAG TTG ATG AAG ATG TTA CCG ATT AAC AAG GTT AGC GAA TCT CAG ATC CAAGAC GCT CAG CGT AAG TTA GCT GTT TTC TCT ATC TTA ATG GAC TCG ATG ACC TTG AAG GAA CGC CGT GAC CCC CGT GTA TTG AAAGCC ATT TCT CGC AAG AAC CGC ATC ATT AAA GGC TCG GGG CGC TCG GAG AAA GAG TTC AAT GAA CTG ATT AAC TCA TTC GAA AAAGGG AAA AAG CAA GTA TTG GAG ATT ACC AAG ATG ATT AAA TCA GGT CGT ATG CCA AAC CTT TCA AAA GGG GGC TTC AAG TTT TCC TAG • Amino Acid sequence: MKNLTNEIYDVIIIGSGPAGLTSAIYTARAGLKTVIYEQSAPGGKLIKTDLIENYPGFETIQGPDLASKMYLQALSLNASVEFVGVNSIFKNADDIFEISLANGETKKAYAVILATGTQENKLGIKGEDELYGKGVSYCAVCDGAFYKNKPVAVVGGGYSAVQEAMYLSQLVDKVYLIVRRDVFRADANKVAKLKAQPNVEFLLKSQVKEIHGTEKVESLTITTPNGEKKLEVSAIFPYIGSTPLIDSVKHLCIENEKGYIPTNDKMQTEIKGLFVAGDVRDVPLRQIAIACGDGAIAGQMAVEYVQEIK

Function and Homologs • Functional Category: Signal recognition particle protein • Product: Signal recognition particle protein • Module: Signal recognition particle protein • Closest homologous proteins: The top (max three) homologous proteins to this protein, as identified by BLAST searches. Name: Signal recognition particle protein [Mycoplasma feriruminatoris], Max Score: 873, Query Cover: 100%, E-Value: 0, Identity: 97%, WP_008363848.1 Name: Signal recognition particle protein [Mycoplasma capricolum], Max Score: 866, Query Cover: 100%, E-Value: 0, Identity: 97%, WP_041159828.1 Name: Signal recognition particle protein [Mycoplasma leachii], Max Score: 837, Query Cover: 100%, E-Value: 0, Identity: 96%, WP_013447849.1

Equivalent E. coli / JCVI functional protein: When the given amino acid sequence was BLAST-ed against the E. coli, the top hits included signal recognition particle protein in Escherichia coli (E. coli). The max score was 324, total score: 324, query cover: 92%, E value: 3e-105, Identity: 42%, Accession Number: WP_032325358.1